PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.23794s0635.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family HD-ZIP
Protein Properties Length: 847aa    MW: 92567.1 Da    PI: 6.1834
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.23794s0635.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.42.4e-181977357
                          --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
              Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                          k  ++t+eq+e+Le+++ ++++ps  +r++L +++    +++ +q+kvWFqNrR +ek+
  Bostr.23794s0635.1.p 19 KYVRYTPEQVEALERVYTECPKPSSLRRQQLIRECpilsNIEPKQIKVWFQNRRCREKQ 77
                          5678*****************************************************97 PP

2START1901.2e-591683762205
                           HHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS.SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-SEEEEEEEECTT.. CS
                 START   2 laeeaaqelvkkalaeepgWvkssesengdevlqkfeeskvdsgealrasgvvdmvlallveellddkeqWdetlakaetlevissg.. 88 
                           +aeea++e+++ka+ ++  Wv++  +++g++++ +++ s+++sg a+ra+g+v  +++  v+e+l+d++ W ++++ ++tl vi  g  
  Bostr.23794s0635.1.p 168 IAEEALAEFLSKATGTAVDWVQMIGMKPGPDSIGIVAISRNCSGMAARACGLVSLEPM-KVAEILKDRPSWLRDCRCVDTLSVIPAGng 255
                           799*******************************************************.8888888888*****************999 PP

                           EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--....-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE-- CS
                 START  89 galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe...sssvvRaellpSgiliepksnghskvtwvehvdlk 173
                           g+++l++++++a+++l++ Rdf+++Ry+ +l++g++v++++S++s +  p+   sss+vRae++pSg+li+p+++g+s +++v+hvdl+
  Bostr.23794s0635.1.p 256 GTIELIYTQMYAPTTLAAaRDFWTLRYSTCLEDGSYVVCERSLTSATGGPTgppSSSFVRAEMRPSGFLIRPCEGGGSILHIVDHVDLD 344
                           ***********************************************9999999*********************************** PP

                           SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
                 START 174 grlphwllrslvksglaegaktwvatlqrqce 205
                           ++++++++r+l++s+ + ++k++va+l++ ++
  Bostr.23794s0635.1.p 345 AWSVPEVMRPLYESSKILAQKMTVAALRHVRQ 376
                           ***************************98765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007115.3211478IPR001356Homeobox domain
SMARTSM003895.7E-151682IPR001356Homeobox domain
SuperFamilySSF466898.55E-171882IPR009057Homeodomain-like
CDDcd000864.06E-161979No hitNo description
PfamPF000466.4E-162077IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.0E-182177IPR009057Homeodomain-like
CDDcd146865.44E-671110No hitNo description
PROSITE profilePS5084827.201158386IPR002913START domain
CDDcd088751.11E-74162378No hitNo description
Gene3DG3DSA:3.30.530.202.8E-22166372IPR023393START-like domain
SMARTSM002344.7E-63167377IPR002913START domain
SuperFamilySSF559614.12E-36167379No hitNo description
PfamPF018526.4E-57168376IPR002913START domain
SuperFamilySSF559614.94E-6415496No hitNo description
SuperFamilySSF559614.94E-6528603No hitNo description
PfamPF086701.2E-48700845IPR013978MEKHLA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009855Biological Processdetermination of bilateral symmetry
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0010072Biological Processprimary shoot apical meristem specification
GO:0080060Biological Processintegument development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 847 aa     Download sequence    Send to blast
MMVHTMNRES PDKGLDSGKY VRYTPEQVEA LERVYTECPK PSSLRRQQLI RECPILSNIE  60
PKQIKVWFQN RRCREKQRKE AARLQTVNRK LNAMNKLLME ENDRLQKQVS HLVYENGHMK  120
HQLHTASGTT TDNSCESVVV SGQQHQQQNP NPQHLQRDAN NPAGLLSIAE EALAEFLSKA  180
TGTAVDWVQM IGMKPGPDSI GIVAISRNCS GMAARACGLV SLEPMKVAEI LKDRPSWLRD  240
CRCVDTLSVI PAGNGGTIEL IYTQMYAPTT LAAARDFWTL RYSTCLEDGS YVVCERSLTS  300
ATGGPTGPPS SSFVRAEMRP SGFLIRPCEG GGSILHIVDH VDLDAWSVPE VMRPLYESSK  360
ILAQKMTVAA LRHVRQIAQE TSGEVQYGGG RQPAVLRTFS QKLCRGFNDA VNGFVDDGWS  420
PMGSDGAEDI TVMINLSPGK FGGSQYGNSF LPSFGSGVLC AKASMLLQNV PPAVLVRFLR  480
EHRSEWADYG VDAYAAASLR ASPFAVPCAR AGGFPSNQVI LPLAQTVEHE ESLEVVRLEG  540
HAYSPEDMGL ARDMYLLQLC SGVDENEVGG CAQLVFAPID ESFADDAPLL PSGFRVIPLE  600
HKSTPNGASA NRTLDLASAL EGSTRQAGEA DPNGCNFRSV LTIAFQFTFD NHSRDSVASM  660
ARQYVRSIVG SIQRVALAIA PRPGSSISPI SVPTSPEALT LVRWISRSYS LHTGADLFGS  720
DSQTSGDTLL HQLWNHTDAI LCCSLKTNAS PVFTFANQTG LDMLETTLVA LQDIMLDKTL  780
DESGRKALCT EFPKIMQQGY AHLPVGVCAS SMGRMVSYEQ ATVWKVLEDD ESNHCLAFMF  840
VNWSFV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4412910.0AJ441291.1 Arabidopsis thaliana mRNA for homeodomain-leucine zipper protein 14 (ATHB-14 gene).
GenBankAY0997910.0AY099791.1 Arabidopsis thaliana homeodomain transcription factor (At2g34710) mRNA, complete cds.
GenBankBT0003350.0BT000335.1 Arabidopsis thaliana homeodomain transcription factor (At2g34710) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010509720.10.0PREDICTED: homeobox-leucine zipper protein ATHB-14
SwissprotO042910.0ATB14_ARATH; Homeobox-leucine zipper protein ATHB-14
TrEMBLD7LH380.0D7LH38_ARALL; Putative uncharacterized protein
STRINGscaffold_402060.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM42562653
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34710.10.0HD-ZIP family protein